(data stored in ACNUC1104 zone)

EMBL: CP002417.PE209

CP002417.PE209       Location/Qualifiers
FT   CDS             222658..223242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0210"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   vap:Vapar_0181 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34432"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B8"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ADU34432.1"
FT                   /translation="MTANIRKLVIQVDEVRKEMGQDVTPPTRRAVAIAVIENPYAGRYS
FT                   ENLDELIAIGEELGALLGQKAVKALGIEPGQAQSYGKAAIVGERGELEHAAAILHPKLG
FT                   APLRVAVEKGAALVPSAKKQGTLGTAIDVPLGHKDAAFVRSHFDAIEARVSDAPRANEI
FT                   VVAVAVTDSGRPLPRIGGLQASEIKGEDGLR"
     MTANIRKLVI QVDEVRKEMG QDVTPPTRRA VAIAVIENPY AGRYSENLDE LIAIGEELGA        60
     LLGQKAVKAL GIEPGQAQSY GKAAIVGERG ELEHAAAILH PKLGAPLRVA VEKGAALVPS       120
     AKKQGTLGTA IDVPLGHKDA AFVRSHFDAI EARVSDAPRA NEIVVAVAVT DSGRPLPRIG       180
     GLQASEIKGE DGLR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page