(data stored in ACNUC1104 zone)

EMBL: CP002417.PE21

CP002417.PE21        Location/Qualifiers
FT   CDS             complement(21473..22042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34244"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0020"
FT                   /protein_id="ADU34244.1"
FT                   /translation="MSTPFFERWFANHFINRIGHKTAFALAMLLCMLWSTAGALRAPAA
FT                   PEAMAASHEWPSQWDGVPLRPLALSEVEQRFADRFPGAIGRMTDGTQTLVMREVKQPTR
FT                   MLHPAADCYRALGYRIEQARLERDAQARLWRCFVAQRHGAQKIRVCERIVDAQGTAFTD
FT                   TSAWYWSAASGQSTGPWQAVTVARPM"
     MSTPFFERWF ANHFINRIGH KTAFALAMLL CMLWSTAGAL RAPAAPEAMA ASHEWPSQWD        60
     GVPLRPLALS EVEQRFADRF PGAIGRMTDG TQTLVMREVK QPTRMLHPAA DCYRALGYRI       120
     EQARLERDAQ ARLWRCFVAQ RHGAQKIRVC ERIVDAQGTA FTDTSAWYWS AASGQSTGPW       180
     QAVTVARPM                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page