(data stored in ACNUC1104 zone)

EMBL: CP002417.PE210

CP002417.PE210       Location/Qualifiers
FT   CDS             223309..224514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0211"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0182 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34433"
FT                   /db_xref="GOA:E6V0B9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0B9"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34433.1"
FT                   /translation="MNPLRLAFCAASVVTLATALVPAHAQGVIKIGEINSYKAQPAFLE
FT                   PYKKGMELAVDEINAKGGINGKKIELISRDDNANPGDAVRVAEELISREKIDVLAGAFL
FT                   SNTGLALTDFAKQKKFFYLAAEPLTDKIVWSNGNKYTYRLRPSTYMQVAMLVPEAAKLK
FT                   KKRWAIVYPNYEYGQSSAATFKTLLKAAQPDVEFVTEQAPPLGKVDSGSVVQALADAKP
FT                   DAIFNVLFGADLSKFVREGNTRGLFKDREVVSVLTGEPEYLDPLKDEAPNGWIVTGYPW
FT                   NGVKTPEHKAFLDAYQAKFKDYPRLGSVVGYSAIHSIAAGIKKAGGTDTEKLVAAFKGL
FT                   QVDTPFGKINYRAQDNQSTMGAYVGKTKNDGGKGVMVDYVYLDGAKFQPSDDEVKKMRP
FT                   AD"
     MNPLRLAFCA ASVVTLATAL VPAHAQGVIK IGEINSYKAQ PAFLEPYKKG MELAVDEINA        60
     KGGINGKKIE LISRDDNANP GDAVRVAEEL ISREKIDVLA GAFLSNTGLA LTDFAKQKKF       120
     FYLAAEPLTD KIVWSNGNKY TYRLRPSTYM QVAMLVPEAA KLKKKRWAIV YPNYEYGQSS       180
     AATFKTLLKA AQPDVEFVTE QAPPLGKVDS GSVVQALADA KPDAIFNVLF GADLSKFVRE       240
     GNTRGLFKDR EVVSVLTGEP EYLDPLKDEA PNGWIVTGYP WNGVKTPEHK AFLDAYQAKF       300
     KDYPRLGSVV GYSAIHSIAA GIKKAGGTDT EKLVAAFKGL QVDTPFGKIN YRAQDNQSTM       360
     GAYVGKTKND GGKGVMVDYV YLDGAKFQPS DDEVKKMRPA D                           401
//

If you have problems or comments...

PBIL Back to PBIL home page