(data stored in ACNUC1104 zone)

EMBL: CP002417.PE212

CP002417.PE212       Location/Qualifiers
FT   CDS             226526..227323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0213"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0185 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34435"
FT                   /db_xref="GOA:E6V0C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34435.1"
FT                   /translation="MSLLKVENLGKSFGGVKAVDGISFELPAGELLALIGPNGAGKSTT
FT                   FNMVNGQLKADQGSITLDGHELVGRKPREIWRKGVGRTFQIAETFASLTVVENVQMALL
FT                   SHDHKLFSMWRRAADHKRDEALALLDQVGMKSQADRPCSVLAYGDVKRVELAIAMANSP
FT                   KLLLMDEPTAGMAPKERNSLMALTKDLVIQRGMAVLFTEHSMDVVFAYADRMIVLARGR
FT                   LIAQGKPLEIRDHPKVQEVYFGSGKTFEKKIAEKAAALGVTTA"
     MSLLKVENLG KSFGGVKAVD GISFELPAGE LLALIGPNGA GKSTTFNMVN GQLKADQGSI        60
     TLDGHELVGR KPREIWRKGV GRTFQIAETF ASLTVVENVQ MALLSHDHKL FSMWRRAADH       120
     KRDEALALLD QVGMKSQADR PCSVLAYGDV KRVELAIAMA NSPKLLLMDE PTAGMAPKER       180
     NSLMALTKDL VIQRGMAVLF TEHSMDVVFA YADRMIVLAR GRLIAQGKPL EIRDHPKVQE       240
     VYFGSGKTFE KKIAEKAAAL GVTTA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page