(data stored in SCRATCH zone)

EMBL: CP002417.PE214

CP002417.PE214       Location/Qualifiers
FT   CDS             228097..228822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0215"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="KEGG: vap:Vapar_0187 nicotinamidase; PFAM:
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34437"
FT                   /db_xref="GOA:E6V0C3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C3"
FT                   /inference="protein motif:PRIAM:3.5.1.19"
FT                   /protein_id="ADU34437.1"
FT                   /translation="MHRRIVLKSAAALGLVSGLGSFGLSAFAAGKIKPGAKAALIVVDV
FT                   QNCFLDGGTLAVKGGNEVIPVINGLAPAFENIVVTQDWHTAGHASFASTYSGKKPFETT
FT                   KLNYGTQVLWPDHCVQGTEDAALGKALKVPTAQLIIRKGFHKEMDSYSAFEEADHKTAT
FT                   GLAGYLKARGIKTVFVTGLATDFCVAWTAMDARKAGFEAYVIEDATRGIDLNGSLAAAW
FT                   KQMSAKGVKRIQSADIQTA"
     MHRRIVLKSA AALGLVSGLG SFGLSAFAAG KIKPGAKAAL IVVDVQNCFL DGGTLAVKGG        60
     NEVIPVINGL APAFENIVVT QDWHTAGHAS FASTYSGKKP FETTKLNYGT QVLWPDHCVQ       120
     GTEDAALGKA LKVPTAQLII RKGFHKEMDS YSAFEEADHK TATGLAGYLK ARGIKTVFVT       180
     GLATDFCVAW TAMDARKAGF EAYVIEDATR GIDLNGSLAA AWKQMSAKGV KRIQSADIQT       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page