(data stored in ACNUC1104 zone)

EMBL: CP002417.PE215

CP002417.PE215       Location/Qualifiers
FT   CDS             228900..230033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0216"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0188 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34438"
FT                   /db_xref="GOA:E6V0C4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V0C4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34438.1"
FT                   /translation="MVAGGAALALGPGLLRSARAENGVTDTTIRIGQSAVFSGPAKDFG
FT                   VDYRAGIKLYFDRVNKSGGINGRKIELVTYDDAYDPAKTAVNTAKLIDEDKVFALTGFV
FT                   ATGNLAAAMPLAEKAGVPMFAPLVGTTSFRTKVNRYLFHVRAGYDLELRKIISHLSTIG
FT                   ISSIAVVFQDSPFGKSNLATCEQLAAEYKVQVVKTLPLAITAEDAKQVATEISAAKPGA
FT                   VVMIMAGRMVETFIRDYRAGGVGAPLYTLSVGITDAAGSAKRLDGKLAGLVTASIVPPP
FT                   QAQRVPIVADYQRDRAEFGEKIDSYTTLEGYIVARVMVEGLRRAGKTLTRDSFIAGLES
FT                   IGSTRFGDFPIDYSAKNHNGSTFVDLEMYTRDGQLRR"
     MVAGGAALAL GPGLLRSARA ENGVTDTTIR IGQSAVFSGP AKDFGVDYRA GIKLYFDRVN        60
     KSGGINGRKI ELVTYDDAYD PAKTAVNTAK LIDEDKVFAL TGFVATGNLA AAMPLAEKAG       120
     VPMFAPLVGT TSFRTKVNRY LFHVRAGYDL ELRKIISHLS TIGISSIAVV FQDSPFGKSN       180
     LATCEQLAAE YKVQVVKTLP LAITAEDAKQ VATEISAAKP GAVVMIMAGR MVETFIRDYR       240
     AGGVGAPLYT LSVGITDAAG SAKRLDGKLA GLVTASIVPP PQAQRVPIVA DYQRDRAEFG       300
     EKIDSYTTLE GYIVARVMVE GLRRAGKTLT RDSFIAGLES IGSTRFGDFP IDYSAKNHNG       360
     STFVDLEMYT RDGQLRR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page