(data stored in ACNUC1104 zone)

EMBL: CP002417.PE219

CP002417.PE219       Location/Qualifiers
FT   CDS             complement(235749..237290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0220"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: vap:Vapar_0216 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34442"
FT                   /db_xref="GOA:E6V178"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V178"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADU34442.1"
FT                   /translation="MSLSLVQSRALLGLEAADVTVEVHLANGLPSFTLVGLAETEVKES
FT                   RDRVRSAIQNAGLEFPNNKKIVVSLAPADLPKDSGRFDLPIALGILAASGQFQGTRLAG
FT                   HEFAGELSLSGELRPVRGALAMALALHTRGVATKLVLPMDSAQEAALVPGGEVYGARHL
FT                   LDVVRQFLPEEDKAAAPEPSDDGWARIYVTPGVAASQYADLAEVKGHVGAKRALEIAAA
FT                   GGHSLLMVGEPGSGKSMLAQRFAGLLPAMSIDEALESAAVASLGGRFATERWMCRPTSA
FT                   PHHTSSAVALVGGGSPPRPGEISRAHHGVLFLDEFPEFARSALEALREPLETGTITIVR
FT                   AARRAEFPARFQLIAAMNPCPCGYLGSSLKSCRCTPDQVSRYQGKLSGPLLDRIDLHIE
FT                   VPAVSAEQLLNSPPGESTESIRSRVVAARERAMQRQGHANQNLQGSAIDKHAELDATAL
FT                   KFIYNAAAKLGWSARSTHRALKVARTIADLASSETVQVMHVAEAVQYRRGLHGVV"
     MSLSLVQSRA LLGLEAADVT VEVHLANGLP SFTLVGLAET EVKESRDRVR SAIQNAGLEF        60
     PNNKKIVVSL APADLPKDSG RFDLPIALGI LAASGQFQGT RLAGHEFAGE LSLSGELRPV       120
     RGALAMALAL HTRGVATKLV LPMDSAQEAA LVPGGEVYGA RHLLDVVRQF LPEEDKAAAP       180
     EPSDDGWARI YVTPGVAASQ YADLAEVKGH VGAKRALEIA AAGGHSLLMV GEPGSGKSML       240
     AQRFAGLLPA MSIDEALESA AVASLGGRFA TERWMCRPTS APHHTSSAVA LVGGGSPPRP       300
     GEISRAHHGV LFLDEFPEFA RSALEALREP LETGTITIVR AARRAEFPAR FQLIAAMNPC       360
     PCGYLGSSLK SCRCTPDQVS RYQGKLSGPL LDRIDLHIEV PAVSAEQLLN SPPGESTESI       420
     RSRVVAARER AMQRQGHANQ NLQGSAIDKH AELDATALKF IYNAAAKLGW SARSTHRALK       480
     VARTIADLAS SETVQVMHVA EAVQYRRGLH GVV                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page