(data stored in ACNUC1104 zone)

EMBL: CP002417.PE224

CP002417.PE224       Location/Qualifiers
FT   CDS             241725..242654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0225"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0221 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34447"
FT                   /db_xref="GOA:E6V183"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V183"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34447.1"
FT                   /translation="MACARALNRSPERKNQVALQHIPPIQCLLTFEAVARLRHAGRAAD
FT                   ELCVTPSAVSHRIRQLEAHVGFKLFGRSDFSLTADGAAYLANVRTGLAALQATPLANAA
FT                   PRATRLRIAVTPTFSRQFLMPRLELFRNIYPDIELVLQVSIPLLDVTAEQADLEVRYGT
FT                   GAYADCEHRLLLEEEVVPACSPSFLNEFGPFDGFRTAAEIASARLIRSPLEPWGTWFAH
FT                   CGIDQPEPHVGSQFNDLGLVYDAAASGFGVALVRQKMGAAWFESGRLVALSDRAVPSPH
FT                   RHTICWQPGTLERWECAAFVDWLAQSLR"
     MACARALNRS PERKNQVALQ HIPPIQCLLT FEAVARLRHA GRAADELCVT PSAVSHRIRQ        60
     LEAHVGFKLF GRSDFSLTAD GAAYLANVRT GLAALQATPL ANAAPRATRL RIAVTPTFSR       120
     QFLMPRLELF RNIYPDIELV LQVSIPLLDV TAEQADLEVR YGTGAYADCE HRLLLEEEVV       180
     PACSPSFLNE FGPFDGFRTA AEIASARLIR SPLEPWGTWF AHCGIDQPEP HVGSQFNDLG       240
     LVYDAAASGF GVALVRQKMG AAWFESGRLV ALSDRAVPSP HRHTICWQPG TLERWECAAF       300
     VDWLAQSLR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page