(data stored in ACNUC1104 zone)

EMBL: CP002417.PE225

CP002417.PE225       Location/Qualifiers
FT   CDS             242785..244287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0226"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0222 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34448"
FT                   /db_xref="GOA:E6V184"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6V184"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34448.1"
FT                   /translation="MNAPLTAVQQDSLQKTERQSQVVRALQVHLPAHALIWHAEDTTPY
FT                   ECDGLTAYRQRPLVVALPETEAQVAAVLKTCHQLGVPVVARGAGTGLSGGAMPHALGVT
FT                   LSLAKFNRILKIDPVSRTAVVQCGVRNLAISEAAAPFNLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTLHNVLRVRGFTAEGDAIEFGGEALDAPGLDLLALVIGSEGMLAVTT
FT                   EVTVKLVPKPQLARCIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVR
FT                   AGYDLDAAAILLCESDGTPEEVEEEIGRMTAVLRGCGATAIAVSNSEEERMKFWSGRKN
FT                   AFPASGRISPDYMCLDSTIPRKRLADILLAIQEMEKKYNLRCCNVFHAGDGNLHPLVLF
FT                   DANDPDELHRCELFGADILETSVAMGGTVSGEHGVGVEKLNSMCVQFTAAENEQMFGVK
FT                   RAFDPAGLLNPGKVIPTLQRCAEYGKQVVRGGKLPHPDLPRF"
     MNAPLTAVQQ DSLQKTERQS QVVRALQVHL PAHALIWHAE DTTPYECDGL TAYRQRPLVV        60
     ALPETEAQVA AVLKTCHQLG VPVVARGAGT GLSGGAMPHA LGVTLSLAKF NRILKIDPVS       120
     RTAVVQCGVR NLAISEAAAP FNLYYAPDPS SQIACTIGGN VAENSGGVHC LKYGLTLHNV       180
     LRVRGFTAEG DAIEFGGEAL DAPGLDLLAL VIGSEGMLAV TTEVTVKLVP KPQLARCIMA       240
     SFDDVRKAGD AVAAVIAAGI IPAGLEMMDK PMTAAVEDFV RAGYDLDAAA ILLCESDGTP       300
     EEVEEEIGRM TAVLRGCGAT AIAVSNSEEE RMKFWSGRKN AFPASGRISP DYMCLDSTIP       360
     RKRLADILLA IQEMEKKYNL RCCNVFHAGD GNLHPLVLFD ANDPDELHRC ELFGADILET       420
     SVAMGGTVSG EHGVGVEKLN SMCVQFTAAE NEQMFGVKRA FDPAGLLNPG KVIPTLQRCA       480
     EYGKQVVRGG KLPHPDLPRF                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page