(data stored in SCRATCH zone)

EMBL: CP002417.PE226

CP002417.PE226       Location/Qualifiers
FT   CDS             244309..245400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0227"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0223 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34449"
FT                   /db_xref="GOA:E6V185"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6V185"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34449.1"
FT                   /translation="MDSALHQIVERIRAATANATPLCIRGGGTKDFYGEALQGDILDTT
FT                   ALTGITSYEPSELVVTVRAGTPLAELEAALAEKGQCLPFEPPHFGSDGTVGGMVAAGLS
FT                   GPARASVGAVRDYVLGATLVNGRGDVLSFGGQVMKNVAGYDVSRVLAGSLGTLGVIAEV
FT                   SLKVLPVAPAEATLEFACSQADALRLLNEWGGRPLPLNASCWFEYAGAGALYLRLRGAV
FT                   AAVEAACTHLGGERKDNARAAADWQALRDQQLPWFDVASGPDALWRLSVPQTAPVLAID
FT                   GNAPLIEWHGGERWYKALPDQAARIREAAHAAGGHATLFRTPASNIPRFDAMSAPIARI
FT                   HRALMQEFDPHRIFNRGRLFADA"
     MDSALHQIVE RIRAATANAT PLCIRGGGTK DFYGEALQGD ILDTTALTGI TSYEPSELVV        60
     TVRAGTPLAE LEAALAEKGQ CLPFEPPHFG SDGTVGGMVA AGLSGPARAS VGAVRDYVLG       120
     ATLVNGRGDV LSFGGQVMKN VAGYDVSRVL AGSLGTLGVI AEVSLKVLPV APAEATLEFA       180
     CSQADALRLL NEWGGRPLPL NASCWFEYAG AGALYLRLRG AVAAVEAACT HLGGERKDNA       240
     RAAADWQALR DQQLPWFDVA SGPDALWRLS VPQTAPVLAI DGNAPLIEWH GGERWYKALP       300
     DQAARIREAA HAAGGHATLF RTPASNIPRF DAMSAPIARI HRALMQEFDP HRIFNRGRLF       360
     ADA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page