(data stored in ACNUC1104 zone)

EMBL: CP002417.PE227

CP002417.PE227       Location/Qualifiers
FT   CDS             245421..246674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0228"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: vap:Vapar_0224
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34450"
FT                   /db_xref="GOA:E6V186"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6V186"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADU34450.1"
FT                   /translation="MQTELAPEFRDTDEGREAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGKAPTRSTQLHLDRCLTCRNCESTCPSGVQYGNLVDIGRKIVDE
FT                   KVPRPAMESAKRWLLKEGLPSPLFGPAMKLAQSVRGLLPDALKAKVPAKQEAGAWPTAT
FT                   HARKVLMLAGCVQPSMMPNINSATARVLDAAGIQVVIAKEAGCCGAVKFHLNDQEGGKA
FT                   QMRANIDAWWPEVERNEVEAIVMNASGCGVTVREYGHLLQHDAAYAAKAARISELTRDL
FT                   SELLPDLLPALKARVRAPEGVVAYHPPCTLQHGQKLRGGVETHLRALGFDVRVAMNESH
FT                   LCCGSAGTYSVLQPELAYPLRDRKLGHLKQLQPTTIASANIGCITHLQSGSGETPVRHW
FT                   VELLDAALDRRPGAQGRA"
     MQTELAPEFR DTDEGREAEA ILRKCVHCGF CTATCPTYQL LGDELDGPRG RIYLIKQVLE        60
     GKAPTRSTQL HLDRCLTCRN CESTCPSGVQ YGNLVDIGRK IVDEKVPRPA MESAKRWLLK       120
     EGLPSPLFGP AMKLAQSVRG LLPDALKAKV PAKQEAGAWP TATHARKVLM LAGCVQPSMM       180
     PNINSATARV LDAAGIQVVI AKEAGCCGAV KFHLNDQEGG KAQMRANIDA WWPEVERNEV       240
     EAIVMNASGC GVTVREYGHL LQHDAAYAAK AARISELTRD LSELLPDLLP ALKARVRAPE       300
     GVVAYHPPCT LQHGQKLRGG VETHLRALGF DVRVAMNESH LCCGSAGTYS VLQPELAYPL       360
     RDRKLGHLKQ LQPTTIASAN IGCITHLQSG SGETPVRHWV ELLDAALDRR PGAQGRA          417
//

If you have problems or comments...

PBIL Back to PBIL home page