(data stored in ACNUC1104 zone)

EMBL: CP002417.PE228

CP002417.PE228       Location/Qualifiers
FT   CDS             246764..247189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34451"
FT                   /db_xref="UniProtKB/TrEMBL:E6V187"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0225"
FT                   /protein_id="ADU34451.1"
FT                   /translation="MSHVIQLPLRRVLLACACVAGAVAAHAQSAMPAWQGAGPTRYVCG
FT                   GIGSDESNAMRGAMKEHPLSLLFARADGAYMASVDVTIKGGDTNSSAAMAFRAGGPVCL
FT                   IDIPDGRYTIDVTTPGGQAKSQTVTVGGGAKTASFRF"
     MSHVIQLPLR RVLLACACVA GAVAAHAQSA MPAWQGAGPT RYVCGGIGSD ESNAMRGAMK        60
     EHPLSLLFAR ADGAYMASVD VTIKGGDTNS SAAMAFRAGG PVCLIDIPDG RYTIDVTTPG       120
     GQAKSQTVTV GGGAKTASFR F                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page