(data stored in ACNUC1104 zone)

EMBL: CP002417.PE229

CP002417.PE229       Location/Qualifiers
FT   CDS             complement(247210..247698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0230"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: vap:Vapar_0226 peroxiredoxin; PFAM:
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34452"
FT                   /db_xref="GOA:E6V188"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6V188"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADU34452.1"
FT                   /translation="MTSVYDFEANQIDGKPVKLSAFKGKVLLIVNTASKCGFTPQFAGL
FT                   EALHEKYADQGLAVLGFPSNQFGSQDPGTNEEIGAFCTKNYGVSFPMMEKIDVNGSNAA
FT                   PLYQWLTKEKPGLLGLTAIKWNFTKFLIGRDGTVLKRYAPLDTPASLTRDVEAALAAG"
     MTSVYDFEAN QIDGKPVKLS AFKGKVLLIV NTASKCGFTP QFAGLEALHE KYADQGLAVL        60
     GFPSNQFGSQ DPGTNEEIGA FCTKNYGVSF PMMEKIDVNG SNAAPLYQWL TKEKPGLLGL       120
     TAIKWNFTKF LIGRDGTVLK RYAPLDTPAS LTRDVEAALA AG                          162
//

If you have problems or comments...

PBIL Back to PBIL home page