(data stored in SCRATCH zone)

EMBL: CP002417.PE23

CP002417.PE23        Location/Qualifiers
FT   CDS             complement(22971..25040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0023"
FT                   /product="NAD(+) ADP-ribosyltransferase"
FT                   /EC_number="2.4.2.30"
FT                   /note="PFAM: Vault protein inter-alpha-trypsin
FT                   domain-containing protein; von Willebrand factor type A;
FT                   protein of unknown function DUF1555; KEGG: vap:Vapar_0022
FT                   vault protein inter-alpha-trypsin domain protein; SMART:
FT                   von Willebrand factor type A; Vault protein
FT                   inter-alpha-trypsin, metazoa"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34246"
FT                   /db_xref="GOA:E6UXQ2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ2"
FT                   /inference="protein motif:PRIAM:2.4.2.30"
FT                   /protein_id="ADU34246.1"
FT                   /translation="MDATTTPRPGRWLWLATVSLATAGFIAMGVRPVHAQEAPAGPRLK
FT                   TESPYFFVKSDDPSVDRLPLKGTEVAVKISGVIADVTVTQTYRNEGQRAIEAKYVFPGS
FT                   TKAAVSGLNVRLADRLITAQIREKQQAQIEYDTAKKEGKTAALLEQHLPNVFLMNVANI
FT                   LPGDDVKVELRYTELLVPQSGNYEFVFPTVVGPRYNSPQSENAQAKWAAQPTLHAGAAP
FT                   STSFKLKATIDTPMGLKEVRSTTHAIDVKKSDEDQHADIALAADGRPADNRDFVLDYRL
FT                   AGEKIESGLMLYKGQGENAENFFLAMVEPPKAVAASAISPRDYIFVVDISGSMHGFPLD
FT                   TAKTVLERLIGGLRPSDTFNVLLFSGSNKMLSPKSVPATRANIEQALATIKNYSGSGST
FT                   ELIPALKRVYAEPKEENVSRTVVVVTDGYVTVEREAFDLVRSNLSKANVFAFGIGSSVN
FT                   RSLMEGIARAGMGEPFIITDPVQAPEQAARFRRMVESPVLTSVKATFGGLDVYDVEPQA
FT                   LPDVLGERPVIVFGKWRGEAKGRVIIEGRSASGPYRQEVRIDDRTRLDTAALRTLWARH
FT                   RIQSLSDQESLEGSAAFKERITELGLKYSLLTQYTSFIAVDKVVRNAAPQNSVDVNQPL
FT                   PMPQGVSDLAGPALGAEVPSTPEPETLGALAVVLSMLAMLRRRARRNDARRFTS"
     MDATTTPRPG RWLWLATVSL ATAGFIAMGV RPVHAQEAPA GPRLKTESPY FFVKSDDPSV        60
     DRLPLKGTEV AVKISGVIAD VTVTQTYRNE GQRAIEAKYV FPGSTKAAVS GLNVRLADRL       120
     ITAQIREKQQ AQIEYDTAKK EGKTAALLEQ HLPNVFLMNV ANILPGDDVK VELRYTELLV       180
     PQSGNYEFVF PTVVGPRYNS PQSENAQAKW AAQPTLHAGA APSTSFKLKA TIDTPMGLKE       240
     VRSTTHAIDV KKSDEDQHAD IALAADGRPA DNRDFVLDYR LAGEKIESGL MLYKGQGENA       300
     ENFFLAMVEP PKAVAASAIS PRDYIFVVDI SGSMHGFPLD TAKTVLERLI GGLRPSDTFN       360
     VLLFSGSNKM LSPKSVPATR ANIEQALATI KNYSGSGSTE LIPALKRVYA EPKEENVSRT       420
     VVVVTDGYVT VEREAFDLVR SNLSKANVFA FGIGSSVNRS LMEGIARAGM GEPFIITDPV       480
     QAPEQAARFR RMVESPVLTS VKATFGGLDV YDVEPQALPD VLGERPVIVF GKWRGEAKGR       540
     VIIEGRSASG PYRQEVRIDD RTRLDTAALR TLWARHRIQS LSDQESLEGS AAFKERITEL       600
     GLKYSLLTQY TSFIAVDKVV RNAAPQNSVD VNQPLPMPQG VSDLAGPALG AEVPSTPEPE       660
     TLGALAVVLS MLAMLRRRAR RNDARRFTS                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page