(data stored in SCRATCH zone)

EMBL: CP002417.PE230

CP002417.PE230       Location/Qualifiers
FT   CDS             complement(247710..248600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0231"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0227 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34453"
FT                   /db_xref="GOA:E6V189"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V189"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34453.1"
FT                   /translation="MPALALIFNAFVWGLSWFPFRHIESHGLHPLWTTCLIYLAIATVM
FT                   GIVRRHAWKSFTAYPMLAVLGLAAGFTNVGFNWAVTQGDVVRVVLLFYLMPLWSVLLGW
FT                   LLLGERPTGGALARVALALTGVVVVLKAPGTDWPVPSSLPDWLGLAAGFSFAVTNIVLR
FT                   HLRPAPGESRALAMFCGCTFVAGIAALVGTSLGAIASPLQATPGWLGWAVLLGAGFVIG
FT                   NVCLQYGAARLAASATSVIMLSEVLFASVSSVALGASTMDPRILTGGALIVLGAVWAAF
FT                   ARTPARGDDRASAST"
     MPALALIFNA FVWGLSWFPF RHIESHGLHP LWTTCLIYLA IATVMGIVRR HAWKSFTAYP        60
     MLAVLGLAAG FTNVGFNWAV TQGDVVRVVL LFYLMPLWSV LLGWLLLGER PTGGALARVA       120
     LALTGVVVVL KAPGTDWPVP SSLPDWLGLA AGFSFAVTNI VLRHLRPAPG ESRALAMFCG       180
     CTFVAGIAAL VGTSLGAIAS PLQATPGWLG WAVLLGAGFV IGNVCLQYGA ARLAASATSV       240
     IMLSEVLFAS VSSVALGAST MDPRILTGGA LIVLGAVWAA FARTPARGDD RASAST           296
//

If you have problems or comments...

PBIL Back to PBIL home page