(data stored in ACNUC1104 zone)

EMBL: CP002417.PE231

CP002417.PE231       Location/Qualifiers
FT   CDS             complement(248671..249975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0232"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0228 lysophospholipid transporter LplT"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34454"
FT                   /db_xref="GOA:E6V190"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V190"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34454.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADQALFVVAVDLMRSSGAPEWQRAALVP
FT                   IFAVFYVVLAPLVGAFADALPKGKVMFISNAIKVIGCLMMLFGSHPLLSYSIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASILLGIVLGGTLVGHAVSSHLLAFDFPL
FT                   IDTGIDSPAEAAISVLILVYMLAAWFNTRIPHTGVEMRPLRSNPEHGFARNLAALLPDF
FT                   WHCNARLWRDRLGQISLATTTLFWGAGGNLKYIVLAWASLALGYNTTQASALTGVVTIG
FT                   TAVGAIVASMRMRLDMATRVIPMGIAMGLMVICMNFIGNVWLAVPFLIILGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQACILLLGGFYSVCTGLGLSAYGAISAFGLVV
FT                   AGCMWLIKRWHENNLKKYPEEVEHLLAIARSDKHH"
     MKRGFYTIMS AQFFSSLADQ ALFVVAVDLM RSSGAPEWQR AALVPIFAVF YVVLAPLVGA        60
     FADALPKGKV MFISNAIKVI GCLMMLFGSH PLLSYSIVGL GAAAYSPAKY GILTELLPAS       120
     QLVKANGWIE GLTIASILLG IVLGGTLVGH AVSSHLLAFD FPLIDTGIDS PAEAAISVLI       180
     LVYMLAAWFN TRIPHTGVEM RPLRSNPEHG FARNLAALLP DFWHCNARLW RDRLGQISLA       240
     TTTLFWGAGG NLKYIVLAWA SLALGYNTTQ ASALTGVVTI GTAVGAIVAS MRMRLDMATR       300
     VIPMGIAMGL MVICMNFIGN VWLAVPFLII LGGLGGFLVV PMNALLQHRG HNLMGAGRSI       360
     AVQNFNEQAC ILLLGGFYSV CTGLGLSAYG AISAFGLVVA GCMWLIKRWH ENNLKKYPEE       420
     VEHLLAIARS DKHH                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page