(data stored in ACNUC1104 zone)

EMBL: CP002417.PE233

CP002417.PE233       Location/Qualifiers
FT   CDS             251266..252015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34456"
FT                   /db_xref="GOA:E6V192"
FT                   /db_xref="UniProtKB/TrEMBL:E6V192"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0230"
FT                   /protein_id="ADU34456.1"
FT                   /translation="MKILSNWRSVRLWETEVERDLHRNHSLRTHGILIGTFTLLLMWGV
FT                   SALQMHLLHVDSLAVRYFLTLGVGYLGYLLVLRWWARRLVEDGVGANLDMGAGDAVDAG
FT                   EFALDVAGSVGRASRASGVGDAADMAGGALELAGASDEGAIIVVPVVAIFLICVAVLFG
FT                   VGSLVLLYFSWDALLAVAIEVAFSYVSARAAVRVAREGWLMAAVRLTWKPLLGALISAV
FT                   ILGALLDHFMPQVNSLPEAVRVLLKTN"
     MKILSNWRSV RLWETEVERD LHRNHSLRTH GILIGTFTLL LMWGVSALQM HLLHVDSLAV        60
     RYFLTLGVGY LGYLLVLRWW ARRLVEDGVG ANLDMGAGDA VDAGEFALDV AGSVGRASRA       120
     SGVGDAADMA GGALELAGAS DEGAIIVVPV VAIFLICVAV LFGVGSLVLL YFSWDALLAV       180
     AIEVAFSYVS ARAAVRVARE GWLMAAVRLT WKPLLGALIS AVILGALLDH FMPQVNSLPE       240
     AVRVLLKTN                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page