(data stored in ACNUC1104 zone)

EMBL: CP002417.PE235

CP002417.PE235       Location/Qualifiers
FT   CDS             253037..253987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0236"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0232 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34458"
FT                   /db_xref="GOA:E6V194"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V194"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34458.1"
FT                   /translation="MDSKQVRGIAPDTWGARKWAGIGAAEVMLLLVAAVWGGSYAVAKQ
FT                   ATQQLPVMEFIALRFGLTFIVLLPALKPLFNAQWRQGLAVGGLLGANLLAIFVCETFGV
FT                   SLTTASNAAFLISLCVALTPFVEWWLLGQRPAQRIFWAAGLSAVGAAMLSATSPANIAV
FT                   GWGDALMVLAAFLRAVMVCMTRRLAGHHAMPALTLTAVQSGVMALGAMAISLLASNGAW
FT                   HMPPATASFWWGMAYLVLLCTVFAFFAQNHAASRSSPSRVSLLMGSEPVFGALIAVYGF
FT                   GETVGVWGWAGGLLIVAAAWWVTMPQKLEARPRIP"
     MDSKQVRGIA PDTWGARKWA GIGAAEVMLL LVAAVWGGSY AVAKQATQQL PVMEFIALRF        60
     GLTFIVLLPA LKPLFNAQWR QGLAVGGLLG ANLLAIFVCE TFGVSLTTAS NAAFLISLCV       120
     ALTPFVEWWL LGQRPAQRIF WAAGLSAVGA AMLSATSPAN IAVGWGDALM VLAAFLRAVM       180
     VCMTRRLAGH HAMPALTLTA VQSGVMALGA MAISLLASNG AWHMPPATAS FWWGMAYLVL       240
     LCTVFAFFAQ NHAASRSSPS RVSLLMGSEP VFGALIAVYG FGETVGVWGW AGGLLIVAAA       300
     WWVTMPQKLE ARPRIP                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page