(data stored in ACNUC1104 zone)

EMBL: CP002417.PE236

CP002417.PE236       Location/Qualifiers
FT   CDS             complement(254203..255180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0237"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   vap:Vapar_0234 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34459"
FT                   /db_xref="GOA:E6V195"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V195"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADU34459.1"
FT                   /translation="MKICIYGAGAIGGWIGAGLAQAGERLNVVARGATLDVLQRDGLSL
FT                   MRADVRTRVPVNAVADPDALGVQDLVVIAVKAPALAAVAERIGPLIGPDTIVLVAMNGV
FT                   PWWFLEGGFGGEITGRRLAAVDPDGAIAKAIPARNVIGCVVHASCSLDGPGVVRHHFGN
FT                   GLIVGEPSGEATPRVQALVELLTRAGINTTLSPQIQKDVWFKLWGNMTVNPISALTGAT
FT                   TDLIMGDDYVRGFISAVMLEAKEIGRRIGIEITQSPEDRHEVTKKLGAFKTSMLQDVEA
FT                   GRSVELDALVTVVRELGELTGVATPFTDALLGLARLRTRQLGLY"
     MKICIYGAGA IGGWIGAGLA QAGERLNVVA RGATLDVLQR DGLSLMRADV RTRVPVNAVA        60
     DPDALGVQDL VVIAVKAPAL AAVAERIGPL IGPDTIVLVA MNGVPWWFLE GGFGGEITGR       120
     RLAAVDPDGA IAKAIPARNV IGCVVHASCS LDGPGVVRHH FGNGLIVGEP SGEATPRVQA       180
     LVELLTRAGI NTTLSPQIQK DVWFKLWGNM TVNPISALTG ATTDLIMGDD YVRGFISAVM       240
     LEAKEIGRRI GIEITQSPED RHEVTKKLGA FKTSMLQDVE AGRSVELDAL VTVVRELGEL       300
     TGVATPFTDA LLGLARLRTR QLGLY                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page