(data stored in ACNUC1104 zone)

EMBL: CP002417.PE237

CP002417.PE237       Location/Qualifiers
FT   CDS             complement(255203..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0238"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: vap:Vapar_0235 aldolase II superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34460"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E6V196"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADU34460.1"
FT                   /translation="MNTSLATSPSALVHPSIHPDERAAREELAACYRVFAMLGWVEMIY
FT                   NHITVRLPDSVTGGEKQFLINPFGLHYSEVTASNLVKIDLQGKVLDGSSYPVNPAGFTV
FT                   HAAIHDGLPGAHCVMHTHTTAGVAVACLEGGLRQTNFYTAQLHGMVAYHDFEGITIHAD
FT                   EGPRLLQSIGNRNAVILRNHGLLAWGQTLPQTFAILWTLQRACEIQMATFSMGAAIPVS
FT                   EEIAERCTRDALQFSPAHGAGQDVFNALVRQVDRIDPSYRN"
     MNTSLATSPS ALVHPSIHPD ERAAREELAA CYRVFAMLGW VEMIYNHITV RLPDSVTGGE        60
     KQFLINPFGL HYSEVTASNL VKIDLQGKVL DGSSYPVNPA GFTVHAAIHD GLPGAHCVMH       120
     THTTAGVAVA CLEGGLRQTN FYTAQLHGMV AYHDFEGITI HADEGPRLLQ SIGNRNAVIL       180
     RNHGLLAWGQ TLPQTFAILW TLQRACEIQM ATFSMGAAIP VSEEIAERCT RDALQFSPAH       240
     GAGQDVFNAL VRQVDRIDPS YRN                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page