(data stored in ACNUC1104 zone)

EMBL: CP002417.PE240

CP002417.PE240       Location/Qualifiers
FT   CDS             complement(257629..258459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0241"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; KEGG: vap:Vapar_0239
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34463"
FT                   /db_xref="GOA:E6V199"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6V199"
FT                   /inference="protein motif:TFAM:TIGR02311"
FT                   /protein_id="ADU34463.1"
FT                   /translation="MHTPINTFKQAMLAGEQKIGLWVGLADGYVAEILAGCGYDWLLVD
FT                   GEHAPNDVRSVLGQLQGISSAWSAQPESERSHPVVRIPTGDTTLIKQYLDIGAQTLLVP
FT                   MVDTAEQAARMVQGMRYPPEGIRGMGSALARASRWQAYPQYLHEANAQTCLLVQAETVE
FT                   AMKNLDAIAATPGVDGVFIGPADLSASMGFVGQPNHPEVQAVIADAIARILKAGKAPGI
FT                   LSTTEEQARKWLAAGALFVAVGVDTIVLTAAAKQLAAKYKNAAGAASGAVPNGY"
     MHTPINTFKQ AMLAGEQKIG LWVGLADGYV AEILAGCGYD WLLVDGEHAP NDVRSVLGQL        60
     QGISSAWSAQ PESERSHPVV RIPTGDTTLI KQYLDIGAQT LLVPMVDTAE QAARMVQGMR       120
     YPPEGIRGMG SALARASRWQ AYPQYLHEAN AQTCLLVQAE TVEAMKNLDA IAATPGVDGV       180
     FIGPADLSAS MGFVGQPNHP EVQAVIADAI ARILKAGKAP GILSTTEEQA RKWLAAGALF       240
     VAVGVDTIVL TAAAKQLAAK YKNAAGAASG AVPNGY                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page