(data stored in ACNUC1104 zone)

EMBL: CP002417.PE244

CP002417.PE244       Location/Qualifiers
FT   CDS             complement(260535..260870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0245"
FT                   /product="Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase LigAB LigA
FT                   subunit; KEGG: dac:Daci_0104 extradiol ring-cleavage
FT                   dioxygenase LigAB LigA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34467"
FT                   /db_xref="GOA:E6V1A3"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1A3"
FT                   /inference="protein motif:PFAM:PF07746"
FT                   /protein_id="ADU34467.1"
FT                   /translation="MSLYAMQKFLFALNREAEVQRRYLDGGDARAALLCAYDFNDEERE
FT                   AIATGDIGKLYVLGCNGQLLMHFAPLLGIAWADYLEAMREGVRKYGPVRAGIYAMTTGT
FT                   NEKVAGV"
     MSLYAMQKFL FALNREAEVQ RRYLDGGDAR AALLCAYDFN DEEREAIATG DIGKLYVLGC        60
     NGQLLMHFAP LLGIAWADYL EAMREGVRKY GPVRAGIYAM TTGTNEKVAG V                111
//

If you have problems or comments...

PBIL Back to PBIL home page