(data stored in SCRATCH zone)

EMBL: CP002417.PE25

CP002417.PE25        Location/Qualifiers
FT   CDS             26705..27997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0025"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: azo:azo0701 putative beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34248"
FT                   /db_xref="GOA:E6UXQ4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ4"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADU34248.1"
FT                   /translation="MKLLRSALGALGWLALAALWFWAWHLKDPHLRFMRAWELPTLLGA
FT                   LGVGAVIAWRFGRRALRPVSLGLVFAALLTALGNEAASLHHRAAVPASSGPLAQMLGAH
FT                   FIVGYDDAKDLHELARKGLIGGVFITGRNVKGRTAIELRKEIDDLQALRREAGLPPLIV
FT                   ATDQEGGAVSRLSPLIERQPGLSTLIDADVPEAELAQRAHAYGAQQGRSLAALGITLNF
FT                   SPVVDLRTGREPGRWDLHTRIDERAISADPALTTQVALAYEQGLESAGVRGTLKHFPGL
FT                   GGVTEDTHHFAATLRTPVARLATHDWKPFQDVSRNSSAAIMLGHVVVPELDAVYPVSFS
FT                   RKIVQQLIRGEWGYQGLLVTDDLTMGAAYNRGLCDATVRALDAGVDLVLIAFDHDKYFD
FT                   AMHCAQQAAQRGALDLPMLERSGARRLQPLR"
     MKLLRSALGA LGWLALAALW FWAWHLKDPH LRFMRAWELP TLLGALGVGA VIAWRFGRRA        60
     LRPVSLGLVF AALLTALGNE AASLHHRAAV PASSGPLAQM LGAHFIVGYD DAKDLHELAR       120
     KGLIGGVFIT GRNVKGRTAI ELRKEIDDLQ ALRREAGLPP LIVATDQEGG AVSRLSPLIE       180
     RQPGLSTLID ADVPEAELAQ RAHAYGAQQG RSLAALGITL NFSPVVDLRT GREPGRWDLH       240
     TRIDERAISA DPALTTQVAL AYEQGLESAG VRGTLKHFPG LGGVTEDTHH FAATLRTPVA       300
     RLATHDWKPF QDVSRNSSAA IMLGHVVVPE LDAVYPVSFS RKIVQQLIRG EWGYQGLLVT       360
     DDLTMGAAYN RGLCDATVRA LDAGVDLVLI AFDHDKYFDA MHCAQQAAQR GALDLPMLER       420
     SGARRLQPLR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page