(data stored in ACNUC1104 zone)

EMBL: CP002417.PE251

CP002417.PE251       Location/Qualifiers
FT   CDS             266307..267695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0252"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: vap:Vapar_0251 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34474"
FT                   /db_xref="GOA:E6V1B0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADU34474.1"
FT                   /translation="MAKDKTTFVCSECGGTSPKWLGKCPSCGAWNTLIEQVAGSNAPAN
FT                   NRFGTQFSPLAGVSELATLSEIEATDIARTPTGIDELDRVLGGGIVSGGVTLIGGDPGI
FT                   GKSTLLLQAVDALQRAGQNALYVTGEESGAQVALRSRRLGLDHSQVQVLAEIQLEKIIA
FT                   TLDATRPAIAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRFAKTSGTAVVLVGHVTK
FT                   EGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTERGLKGVAN
FT                   PSAIFLSQHAEPVPGSVVLVTLEGTRPMLVEIQALVDNGGPSPRRLSVGLDRDRLAMLL
FT                   AVLHRHAGVACMDQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKPLPKGFIAFGEVG
FT                   LAGEVRPAPRGQERLREAAKLGFSIAVVPKANAPRKGSKEIEGLTIHPVERIEEAMDVV
FT                   RRLD"
     MAKDKTTFVC SECGGTSPKW LGKCPSCGAW NTLIEQVAGS NAPANNRFGT QFSPLAGVSE        60
     LATLSEIEAT DIARTPTGID ELDRVLGGGI VSGGVTLIGG DPGIGKSTLL LQAVDALQRA       120
     GQNALYVTGE ESGAQVALRS RRLGLDHSQV QVLAEIQLEK IIATLDATRP AIAVIDSIQT       180
     VYSDQLTSAP GSVAQVRECA AHLTRFAKTS GTAVVLVGHV TKEGALAGPR VLEHMVDTVL       240
     YFEGDTHSSF RLVRAIKNRF GAVNEIGVFA MTERGLKGVA NPSAIFLSQH AEPVPGSVVL       300
     VTLEGTRPML VEIQALVDNG GPSPRRLSVG LDRDRLAMLL AVLHRHAGVA CMDQDVFVNA       360
     VGGVRISEPA ADLAVMLAIT SSLRGKPLPK GFIAFGEVGL AGEVRPAPRG QERLREAAKL       420
     GFSIAVVPKA NAPRKGSKEI EGLTIHPVER IEEAMDVVRR LD                          462
//

If you have problems or comments...

PBIL Back to PBIL home page