(data stored in ACNUC1104 zone)

EMBL: CP002417.PE252

CP002417.PE252       Location/Qualifiers
FT   CDS             complement(267753..268208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU02768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34475"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B1"
FT                   /inference="similar to AA sequence:KEGG:NCU02768"
FT                   /protein_id="ADU34475.1"
FT                   /translation="MNISRSATIVRLTLAATLTAAALSGCYVVPIAQPAPAAPPSQAYA
FT                   VAPGPIAQSFSARLYPSNAEAARYGTVAGTVTNDMNGRGHFNAQIGGEQFQGEATRVAG
FT                   SRGAGVANASGNRGGNLSCQYTMNSATLGSGQCVLNSGPAFTMHIGG"
     MNISRSATIV RLTLAATLTA AALSGCYVVP IAQPAPAAPP SQAYAVAPGP IAQSFSARLY        60
     PSNAEAARYG TVAGTVTNDM NGRGHFNAQI GGEQFQGEAT RVAGSRGAGV ANASGNRGGN       120
     LSCQYTMNSA TLGSGQCVLN SGPAFTMHIG G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page