(data stored in SCRATCH zone)

EMBL: CP002417.PE253

CP002417.PE253       Location/Qualifiers
FT   CDS             268403..268831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34476"
FT                   /db_xref="GOA:E6V1B2"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0252"
FT                   /protein_id="ADU34476.1"
FT                   /translation="MRAMNFQKLLVPVGGIVLLGLAWRSYGWAGVALTGGVIVMFLLLH
FT                   FNRAMQVLKRAADRPVGYVASAVMLNAKLKQGATLMHVIAMTRALGELRSPADTQPELY
FT                   RWTDTGGSYVDAVFNGGKLQSWEMTRPEAAPEEETPAS"
     MRAMNFQKLL VPVGGIVLLG LAWRSYGWAG VALTGGVIVM FLLLHFNRAM QVLKRAADRP        60
     VGYVASAVML NAKLKQGATL MHVIAMTRAL GELRSPADTQ PELYRWTDTG GSYVDAVFNG       120
     GKLQSWEMTR PEAAPEEETP AS                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page