(data stored in ACNUC1104 zone)

EMBL: CP002417.PE256

CP002417.PE256       Location/Qualifiers
FT   CDS             271303..272517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0257"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: rpf:Rpic12D_1452 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34479"
FT                   /db_xref="GOA:E6V1B5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B5"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADU34479.1"
FT                   /translation="MTRELSLQTSRLLSRLLPQADVDTQAFIDIRRQIHANPELGFEVG
FT                   ATGELVANLLREWGYEVHTGIGKTGIVAQLKVGSGTRRLGIRADMDALPIVEATGLPYA
FT                   SKTHGRMHACGHDGHTAILLAAAKALAKRRDFDGTLNLIFQPDEENLCGARAMIEDGLF
FT                   ERFPCDAVYALHNAPGVPVGSFLVIEGPVTLSSDVADVTIKGVGGHGAMPHLSRDPVPA
FT                   AAAVVTALQTVVARNVTPGDTAVVSVGFIRGGATHNVIPQSVALGLNVRAARPETRAVV
FT                   EQRIREIVSLTAQAHGVEAEIDYRQLVPPVVNTAAECRLMAQVCAELVGAEHVVTEAPK
FT                   GFAGSEDFAWMLAELPGCYVLLGNGEGEFGGCMVHNPGYDFNDQVLPLGAACWVRLAQT
FT                   YLAKT"
     MTRELSLQTS RLLSRLLPQA DVDTQAFIDI RRQIHANPEL GFEVGATGEL VANLLREWGY        60
     EVHTGIGKTG IVAQLKVGSG TRRLGIRADM DALPIVEATG LPYASKTHGR MHACGHDGHT       120
     AILLAAAKAL AKRRDFDGTL NLIFQPDEEN LCGARAMIED GLFERFPCDA VYALHNAPGV       180
     PVGSFLVIEG PVTLSSDVAD VTIKGVGGHG AMPHLSRDPV PAAAAVVTAL QTVVARNVTP       240
     GDTAVVSVGF IRGGATHNVI PQSVALGLNV RAARPETRAV VEQRIREIVS LTAQAHGVEA       300
     EIDYRQLVPP VVNTAAECRL MAQVCAELVG AEHVVTEAPK GFAGSEDFAW MLAELPGCYV       360
     LLGNGEGEFG GCMVHNPGYD FNDQVLPLGA ACWVRLAQTY LAKT                        404
//

If you have problems or comments...

PBIL Back to PBIL home page