(data stored in SCRATCH zone)

EMBL: CP002417.PE258

CP002417.PE258       Location/Qualifiers
FT   CDS             274043..274996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0259"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="KEGG: vap:Vapar_0254 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34481"
FT                   /db_xref="GOA:E6V1B7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B7"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADU34481.1"
FT                   /translation="MSSIPPSLDDRDGKIWMDGELVDWRDAKIHVLSHTLHYGCGAFEG
FT                   VRAYKTADGGTSIFRLAEHTERLFNSAKILRMKIPFSQEQLNEAQKQVVRENKLESCYL
FT                   RPLIWIGSEKLGVSPKGNKIHAMVAAWSWGAYLGEEGMRRGIRVKTSSYTRHHVNITMT
FT                   QAKSVSNYTNSILANMEALDDGYDEALLLDASGFVSEGAGENIFVVKGGVVYTPDLSAG
FT                   ALNGITRNTILHICKDLGLELVQKRITRDEVYISDEAFFTGTAAEVTPIRELDRIEIGN
FT                   RGDGGSRGPITEKIQSAFFDIVNGKNPKYAHWLTKV"
     MSSIPPSLDD RDGKIWMDGE LVDWRDAKIH VLSHTLHYGC GAFEGVRAYK TADGGTSIFR        60
     LAEHTERLFN SAKILRMKIP FSQEQLNEAQ KQVVRENKLE SCYLRPLIWI GSEKLGVSPK       120
     GNKIHAMVAA WSWGAYLGEE GMRRGIRVKT SSYTRHHVNI TMTQAKSVSN YTNSILANME       180
     ALDDGYDEAL LLDASGFVSE GAGENIFVVK GGVVYTPDLS AGALNGITRN TILHICKDLG       240
     LELVQKRITR DEVYISDEAF FTGTAAEVTP IRELDRIEIG NRGDGGSRGP ITEKIQSAFF       300
     DIVNGKNPKY AHWLTKV                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page