(data stored in SCRATCH zone)

EMBL: CP002417.PE260

CP002417.PE260       Location/Qualifiers
FT   CDS             275232..275648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34483"
FT                   /db_xref="GOA:E6V1B9"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1B9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0256"
FT                   /protein_id="ADU34483.1"
FT                   /translation="MTLRGLLWRFAAAYVVLLIVVGVALNLAGASSSTGGNMAALLGTV
FT                   AWVCMDSAKKNGRYFTPEEKKRAVLGMLVIDMAIQAAVTVAVGLFAGATGLSLGPALLV
FT                   LLFVGVLHALVIWFFVGFAGKQHAAAEARRNKIG"
     MTLRGLLWRF AAAYVVLLIV VGVALNLAGA SSSTGGNMAA LLGTVAWVCM DSAKKNGRYF        60
     TPEEKKRAVL GMLVIDMAIQ AAVTVAVGLF AGATGLSLGP ALLVLLFVGV LHALVIWFFV       120
     GFAGKQHAAA EARRNKIG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page