(data stored in ACNUC1104 zone)

EMBL: CP002417.PE263

CP002417.PE263       Location/Qualifiers
FT   CDS             complement(278105..279304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0264"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: vap:Vapar_0258 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34486"
FT                   /db_xref="GOA:E6V1C2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34486.1"
FT                   /translation="MLRKLYSGHLYVRIWLAVVGGVVILTLMANWIVREAAEAERERLA
FT                   PVPRHVVVLDAQDRTIGSGTALRVPGQGLEFDVTLSDGKAITLRVAPRERATGTGGFAP
FT                   WRTPFGLGWMIALVGVAVALGVYPIVRRITQRLETLQRGVQRWGDGDLSVRVTEEGQDE
FT                   VADLSKRFNASAERIEQLVRSHKSLLANASHELRSPLTRIRMGLELMGEHPSPKAREEI
FT                   SRNIGELDQLIDEILLASRLDASEADMGTIEAVDLTGLAAEECSQVNAELDLAEGTDNA
FT                   ALTVPGVSRLLRRAIRNLLENARRYGAGSISVELGSANGFATVRVNDRGPGVPPALRER
FT                   IFEPFYRLPGASERNGGVGLGLALVKSIAERHGGTVRCEDAPEGGASFVIRLPVAATAH
FT                   "
     MLRKLYSGHL YVRIWLAVVG GVVILTLMAN WIVREAAEAE RERLAPVPRH VVVLDAQDRT        60
     IGSGTALRVP GQGLEFDVTL SDGKAITLRV APRERATGTG GFAPWRTPFG LGWMIALVGV       120
     AVALGVYPIV RRITQRLETL QRGVQRWGDG DLSVRVTEEG QDEVADLSKR FNASAERIEQ       180
     LVRSHKSLLA NASHELRSPL TRIRMGLELM GEHPSPKARE EISRNIGELD QLIDEILLAS       240
     RLDASEADMG TIEAVDLTGL AAEECSQVNA ELDLAEGTDN AALTVPGVSR LLRRAIRNLL       300
     ENARRYGAGS ISVELGSANG FATVRVNDRG PGVPPALRER IFEPFYRLPG ASERNGGVGL       360
     GLALVKSIAE RHGGTVRCED APEGGASFVI RLPVAATAH                              399
//

If you have problems or comments...

PBIL Back to PBIL home page