(data stored in ACNUC1104 zone)

EMBL: CP002417.PE267

CP002417.PE267       Location/Qualifiers
FT   CDS             complement(282619..283827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0268"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: vap:Vapar_0262
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34490"
FT                   /db_xref="GOA:E6V1C6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C6"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADU34490.1"
FT                   /translation="MLSRISPLQISAYTATSAVGVGKAPLAEALENSRSGLRANDFGDA
FT                   PLPTWIGRVEGLEDVRLPEPLASWDCRNNRLAWLGLQADGFLEAVAAARKKYGASRVAL
FT                   ILGTSTSSIGETELAYTQLDGNGMFPPDQRRAAVHTPHSLAMFVRQVLGLEGPAETIST
FT                   ACSSSAKVFASAERLIRLGLADAAVVGGVDTLCGSVLFGFNSLELVSTEPCRPFDAGRD
FT                   GISLGEAAGFALVERVQGGADAAPLRLLGYGEASDAHHMSTPHPEGLGAERALDEALLR
FT                   AGLPPEAIDYINMHGTASQKNDEVEGALVARRFPATTHASSTKGFMGHTLGAAGIVEAV
FT                   ISLLAIERGLKPGTVGTRTIDEGFGPQIRLAPEHGEVRYALSNSFGFGGNNCSLVFGKA
FT                   DAA"
     MLSRISPLQI SAYTATSAVG VGKAPLAEAL ENSRSGLRAN DFGDAPLPTW IGRVEGLEDV        60
     RLPEPLASWD CRNNRLAWLG LQADGFLEAV AAARKKYGAS RVALILGTST SSIGETELAY       120
     TQLDGNGMFP PDQRRAAVHT PHSLAMFVRQ VLGLEGPAET ISTACSSSAK VFASAERLIR       180
     LGLADAAVVG GVDTLCGSVL FGFNSLELVS TEPCRPFDAG RDGISLGEAA GFALVERVQG       240
     GADAAPLRLL GYGEASDAHH MSTPHPEGLG AERALDEALL RAGLPPEAID YINMHGTASQ       300
     KNDEVEGALV ARRFPATTHA SSTKGFMGHT LGAAGIVEAV ISLLAIERGL KPGTVGTRTI       360
     DEGFGPQIRL APEHGEVRYA LSNSFGFGGN NCSLVFGKAD AA                          402
//

If you have problems or comments...

PBIL Back to PBIL home page