(data stored in ACNUC1104 zone)

EMBL: CP002417.PE27

CP002417.PE27        Location/Qualifiers
FT   CDS             30489..31094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34250"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0025"
FT                   /protein_id="ADU34250.1"
FT                   /translation="MEILTLVALLLVGAYILKSRDQRQRIALLGSHLGQYQIEKLMESL
FT                   TQGYLRCLGEDDPERRQQIWSLLDTTEEKLSSQFDSFAAGFARLPEADTRVSKLPIAIP
FT                   YAHKLFPSTTFDLREALNIHARGIAGVMKNASSRPAKSKAFTMSAELFLMQHTCHWFCK
FT                   SKTVASARMLARHQTSYEQLLDAVSPETRRAYGTLTGQ"
     MEILTLVALL LVGAYILKSR DQRQRIALLG SHLGQYQIEK LMESLTQGYL RCLGEDDPER        60
     RQQIWSLLDT TEEKLSSQFD SFAAGFARLP EADTRVSKLP IAIPYAHKLF PSTTFDLREA       120
     LNIHARGIAG VMKNASSRPA KSKAFTMSAE LFLMQHTCHW FCKSKTVASA RMLARHQTSY       180
     EQLLDAVSPE TRRAYGTLTG Q                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page