(data stored in SCRATCH zone)

EMBL: CP002417.PE270

CP002417.PE270       Location/Qualifiers
FT   CDS             286517..288232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0271"
FT                   /product="allophanate hydrolase"
FT                   /note="KEGG: vap:Vapar_0265 allophanate hydrolase; TIGRFAM:
FT                   allophanate hydrolase; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34493"
FT                   /db_xref="GOA:E6V1C9"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1C9"
FT                   /inference="protein motif:TFAM:TIGR02713"
FT                   /protein_id="ADU34493.1"
FT                   /translation="MVHEYDPLTAAAWIAKFPTPVAGAETADTPGVTLPLAGLRFAVKD
FT                   NIDVAGVPTTAACPAFDRRPTAHAAVVQRLLEAGASLAGKTNLDQFACGLNGTRSPYGE
FT                   VPNAFDARYVSGGSSSGSAYVVAAGEVDFALGTDTAGSGRVPAGLNNIVGLKPSRGLLS
FT                   TFGVVPAAQSADCVSIFARTVALAVDVMLAASGHDPRDPYSRDIAMHRKPLPARFNFGV
FT                   PDTLSFFGDTVAEEAFRDAQAKLVALGGTAVTIPYAPLAEAAALLYESALVAERYAAVR
FT                   EFFDAHADEVIEPVRSILASGKKYVAADVFDAQTRLRAIAQQVEPMWRDIDVLLVPTAP
FT                   THYTREAMRADPVVLNRNLGAYTNFVNLLDYAALSVPSSLRADGLPFGITLIGPSGSDL
FT                   ALADLGQRYHHATGLAQGATGQPLPAPRPVPGLMAPVPQTLAIAVVGAHLSGMPLNGQL
FT                   TERGATLLRATTTSPAYRLFALPGTTPPKPGLQRSAEGGAAIALEVWAVPIAQVGSFLA
FT                   LIPPPLGLGSVELADGSWVHGFICEGHALADGQDVTHHGGWRAYVASRATTPSN"
     MVHEYDPLTA AAWIAKFPTP VAGAETADTP GVTLPLAGLR FAVKDNIDVA GVPTTAACPA        60
     FDRRPTAHAA VVQRLLEAGA SLAGKTNLDQ FACGLNGTRS PYGEVPNAFD ARYVSGGSSS       120
     GSAYVVAAGE VDFALGTDTA GSGRVPAGLN NIVGLKPSRG LLSTFGVVPA AQSADCVSIF       180
     ARTVALAVDV MLAASGHDPR DPYSRDIAMH RKPLPARFNF GVPDTLSFFG DTVAEEAFRD       240
     AQAKLVALGG TAVTIPYAPL AEAAALLYES ALVAERYAAV REFFDAHADE VIEPVRSILA       300
     SGKKYVAADV FDAQTRLRAI AQQVEPMWRD IDVLLVPTAP THYTREAMRA DPVVLNRNLG       360
     AYTNFVNLLD YAALSVPSSL RADGLPFGIT LIGPSGSDLA LADLGQRYHH ATGLAQGATG       420
     QPLPAPRPVP GLMAPVPQTL AIAVVGAHLS GMPLNGQLTE RGATLLRATT TSPAYRLFAL       480
     PGTTPPKPGL QRSAEGGAAI ALEVWAVPIA QVGSFLALIP PPLGLGSVEL ADGSWVHGFI       540
     CEGHALADGQ DVTHHGGWRA YVASRATTPS N                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page