(data stored in ACNUC1104 zone)

EMBL: CP002417.PE271

CP002417.PE271       Location/Qualifiers
FT   CDS             288254..289258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0272"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="KEGG: vap:Vapar_0266 NMT1/THI5 like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34494"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0266"
FT                   /protein_id="ADU34494.1"
FT                   /translation="MSTFDKSSASRRQLLQAGIGAAGLAVLAAPAIVRAQAAPKLRIGY
FT                   WPVAAGLPFFAAVDRGYFKEAGLDVEPLKFAAAQQIMEGMLAGRCDGSANGTGSANLAI
FT                   GEIAQPGLFKIFCTNPSNAKFVLDEFIVAKDSPVKTVAELAGKKVASGPGIQNVTLCKT
FT                   MLERAGAKGAVVSELPIGQHVAALAAGQVDACYTLEPTGTVGRMNGTTRVIEAGVVARY
FT                   ILGDPMAPWHGGAASLTSEFIKKNPEVAKKYIAAYARGVELVRTKPDDARQHMKGYTAI
FT                   EGKLTAEVPLASYMLYNEFKPSDVAYFQKFYDLFTEKGIFEKKVPVDALLYKA"
     MSTFDKSSAS RRQLLQAGIG AAGLAVLAAP AIVRAQAAPK LRIGYWPVAA GLPFFAAVDR        60
     GYFKEAGLDV EPLKFAAAQQ IMEGMLAGRC DGSANGTGSA NLAIGEIAQP GLFKIFCTNP       120
     SNAKFVLDEF IVAKDSPVKT VAELAGKKVA SGPGIQNVTL CKTMLERAGA KGAVVSELPI       180
     GQHVAALAAG QVDACYTLEP TGTVGRMNGT TRVIEAGVVA RYILGDPMAP WHGGAASLTS       240
     EFIKKNPEVA KKYIAAYARG VELVRTKPDD ARQHMKGYTA IEGKLTAEVP LASYMLYNEF       300
     KPSDVAYFQK FYDLFTEKGI FEKKVPVDAL LYKA                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page