(data stored in SCRATCH zone)

EMBL: CP002417.PE272

CP002417.PE272       Location/Qualifiers
FT   CDS             289261..290088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0273"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0267
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34495"
FT                   /db_xref="GOA:E6V1D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34495.1"
FT                   /translation="MADASTTTAAPWTPPASLNAAVPKPPLRDRLLPFIGPVALFIAWD
FT                   LVVRLGFIKPILLPSPADTIAALITGLAGGPLLTDFAMTVWRTLQAFVIAAVVGVPLGV
FT                   LLGSNEKAYRSVEFLIDFFRSTPSSALIPLFLLIFGVSDVNKIAIAAFGALLIVVFNSA
FT                   YGVINARKQRVMAAKVMGASRWQVFKDVLIWESLQPSFVGLRSAVSMALVIVIVAEMFI
FT                   GSDTGLGHRIIDAQQVLNVKSMYAAILAAGALGYALNILFLLAERRIVHWSGR"
     MADASTTTAA PWTPPASLNA AVPKPPLRDR LLPFIGPVAL FIAWDLVVRL GFIKPILLPS        60
     PADTIAALIT GLAGGPLLTD FAMTVWRTLQ AFVIAAVVGV PLGVLLGSNE KAYRSVEFLI       120
     DFFRSTPSSA LIPLFLLIFG VSDVNKIAIA AFGALLIVVF NSAYGVINAR KQRVMAAKVM       180
     GASRWQVFKD VLIWESLQPS FVGLRSAVSM ALVIVIVAEM FIGSDTGLGH RIIDAQQVLN       240
     VKSMYAAILA AGALGYALNI LFLLAERRIV HWSGR                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page