(data stored in ACNUC1104 zone)

EMBL: CP002417.PE273

CP002417.PE273       Location/Qualifiers
FT   CDS             290085..290918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0274"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0268 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34496"
FT                   /db_xref="GOA:E6V1D2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34496.1"
FT                   /translation="MKVTQDIVINGPVYADVPKPVFKPGPAGTHITIRGLTKYFAGWPL
FT                   YENFDLDIPKHKIVSVFGPNGCGKSTLINMIAGLVPIDAGEILFDGKQRKDTKIGYVFQ
FT                   NYREAMFPWMRTIDNIAYPLKLEGRSKAEVDRRMEELVASFDVKFDLKRFPYELSGGQQ
FT                   QTASIMRALAPNPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAV
FT                   YLADEVLLLTKRPTKVAEILRYGDARPRTVETLSTESFVATKKLSLDIFQREVRR"
     MKVTQDIVIN GPVYADVPKP VFKPGPAGTH ITIRGLTKYF AGWPLYENFD LDIPKHKIVS        60
     VFGPNGCGKS TLINMIAGLV PIDAGEILFD GKQRKDTKIG YVFQNYREAM FPWMRTIDNI       120
     AYPLKLEGRS KAEVDRRMEE LVASFDVKFD LKRFPYELSG GQQQTASIMR ALAPNPEVLF       180
     LDEPFSALDF EMTLFIREKL QEVFMQTGTT MLLVSHDLEE AVYLADEVLL LTKRPTKVAE       240
     ILRYGDARPR TVETLSTESF VATKKLSLDI FQREVRR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page