(data stored in SCRATCH zone)

EMBL: CP002417.PE278

CP002417.PE278       Location/Qualifiers
FT   CDS             294644..295636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0279"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bra:BRADO7112 formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34501"
FT                   /db_xref="GOA:E6V1D7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1D7"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADU34501.1"
FT                   /translation="MSGLGGLNKSAHGVVVGLVQLQLPNVKTPADLAAQTQRICDMVGK
FT                   ARRNQSTMDLVVFPEYALHGLSMDTNPEIMCTLDGPEVAAFKRACIEHRIWGCFSIMEA
FT                   NPGGNPYNSGLVIDDQGEIKLYYRKLHPWVPVEPWEPGNLGIPVCDGPNGSKLALIICH
FT                   DGMFPEMAREAAYKGADIILRTAGYTAPIRHAWKITNQANAFCNLAYTASVCLCGSDGS
FT                   FDSMGEGMFCNFDGTVLVEGGGRVDEIITAELRPDLVREARTGWGVENNIYQLYHRGYV
FT                   AVKGGAQDCPYTYMHDMAAGTYRLPWSADVKVTDGTSCGFAPPERNYQG"
     MSGLGGLNKS AHGVVVGLVQ LQLPNVKTPA DLAAQTQRIC DMVGKARRNQ STMDLVVFPE        60
     YALHGLSMDT NPEIMCTLDG PEVAAFKRAC IEHRIWGCFS IMEANPGGNP YNSGLVIDDQ       120
     GEIKLYYRKL HPWVPVEPWE PGNLGIPVCD GPNGSKLALI ICHDGMFPEM AREAAYKGAD       180
     IILRTAGYTA PIRHAWKITN QANAFCNLAY TASVCLCGSD GSFDSMGEGM FCNFDGTVLV       240
     EGGGRVDEII TAELRPDLVR EARTGWGVEN NIYQLYHRGY VAVKGGAQDC PYTYMHDMAA       300
     GTYRLPWSAD VKVTDGTSCG FAPPERNYQG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page