(data stored in ACNUC1104 zone)

EMBL: CP002417.PE282

CP002417.PE282       Location/Qualifiers
FT   CDS             298652..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0283"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vap:Vapar_0276 transcriptional regulator, GntR
FT                   family; PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34505"
FT                   /db_xref="GOA:E6V1E1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADU34505.1"
FT                   /translation="MSTVRPRPAPSAPAPAADTAVFRTRADEVYAQLKRDVAEFILVPG
FT                   DRFTENEISDRLGVSRTPVRQALFRLQQEGFVEVLFRSGWRVLPFDFDQFEQLYDLRMV
FT                   LETTAVHRICEADHRVDRSLLDMLAGIWLVPVAERSTDTAQVAQWDEAFHCSLVAAAGN
FT                   AEMARVHSDVTDRIRIIRRLDFTQQPRIEATYDEHAKILKAIRANRGDQAAMLLRAHIE
FT                   TSQAEVRKITLHQVHLARHAGKTAPR"
     MSTVRPRPAP SAPAPAADTA VFRTRADEVY AQLKRDVAEF ILVPGDRFTE NEISDRLGVS        60
     RTPVRQALFR LQQEGFVEVL FRSGWRVLPF DFDQFEQLYD LRMVLETTAV HRICEADHRV       120
     DRSLLDMLAG IWLVPVAERS TDTAQVAQWD EAFHCSLVAA AGNAEMARVH SDVTDRIRII       180
     RRLDFTQQPR IEATYDEHAK ILKAIRANRG DQAAMLLRAH IETSQAEVRK ITLHQVHLAR       240
     HAGKTAPR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page