(data stored in SCRATCH zone)

EMBL: CP002417.PE283

CP002417.PE283       Location/Qualifiers
FT   CDS             complement(299443..300405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_5386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34506"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_5386"
FT                   /protein_id="ADU34506.1"
FT                   /translation="MRFIAKTLTTLLVAASAAAAHAWPDQPITLVVPYTPGTGIDLVAR
FT                   QLSARLPALLGQPVIVENLAGASGNIGSEKVARAKPDGYTLLVQVNTLVMNRSLYKSLS
FT                   YDPVADFAPASLTSWGTLLLVTNPNVQKATSVAQMVSAAKAEPAKLTYATPGVGTPHHL
FT                   SMALLMQGTGTDLLHVPYKGTAGAVTDLLGGRIDYMFLPVHVALQHIQAGKLKAIATGS
FT                   SKRLPQLPDVPTLAEAGVTADNVDMWYGVLAPKGTPPDVVARLNKEIAAVLKQPDVAKS
FT                   FESQGMVPASSTPGEFGALVKKDAERWAGVVKRGNITAD"
     MRFIAKTLTT LLVAASAAAA HAWPDQPITL VVPYTPGTGI DLVARQLSAR LPALLGQPVI        60
     VENLAGASGN IGSEKVARAK PDGYTLLVQV NTLVMNRSLY KSLSYDPVAD FAPASLTSWG       120
     TLLLVTNPNV QKATSVAQMV SAAKAEPAKL TYATPGVGTP HHLSMALLMQ GTGTDLLHVP       180
     YKGTAGAVTD LLGGRIDYMF LPVHVALQHI QAGKLKAIAT GSSKRLPQLP DVPTLAEAGV       240
     TADNVDMWYG VLAPKGTPPD VVARLNKEIA AVLKQPDVAK SFESQGMVPA SSTPGEFGAL       300
     VKKDAERWAG VVKRGNITAD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page