(data stored in ACNUC1104 zone)

EMBL: CP002417.PE284

CP002417.PE284       Location/Qualifiers
FT   CDS             complement(300449..301690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0285"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34507"
FT                   /db_xref="GOA:E6V1E3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E3"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34507.1"
FT                   /translation="MNDKQVIILGAGIGGLTLALSLHQAGIACRVYEAVPELEPLGVGV
FT                   NLLPHAVRELTELGLLPQLDKVGVRTKESIFFTEHGQLIFQEAAGEHAGYDWPQFSIHR
FT                   GDLQTVLLEETLKRLGPDSVVCNHRCTGVTQDAGGVTVHFADAPAVRGAVAIGCDGIHS
FT                   ALRKQLYPNEGAPRYSGVNMWRGTARWKPFLSGASMVRAGWLAVGKMVIYPIRNDIDAE
FT                   GHQLVNWVAEIHAPQPAMRDWSRAGRLEDFLPAFADWHFYWLDVPALIRASDTILEYPM
FT                   VDQDPLPRWTHGRLTLLGDAAHPMVPRGSNGAGQAIIDARFLAGALKDLGVGTAALEDY
FT                   DRARVKATTNVVLTNRSNPPDAILREVFERSGGKRFGQIEDVVSHAELQAISDNYKRVA
FT                   GYDPVALKARASYL"
     MNDKQVIILG AGIGGLTLAL SLHQAGIACR VYEAVPELEP LGVGVNLLPH AVRELTELGL        60
     LPQLDKVGVR TKESIFFTEH GQLIFQEAAG EHAGYDWPQF SIHRGDLQTV LLEETLKRLG       120
     PDSVVCNHRC TGVTQDAGGV TVHFADAPAV RGAVAIGCDG IHSALRKQLY PNEGAPRYSG       180
     VNMWRGTARW KPFLSGASMV RAGWLAVGKM VIYPIRNDID AEGHQLVNWV AEIHAPQPAM       240
     RDWSRAGRLE DFLPAFADWH FYWLDVPALI RASDTILEYP MVDQDPLPRW THGRLTLLGD       300
     AAHPMVPRGS NGAGQAIIDA RFLAGALKDL GVGTAALEDY DRARVKATTN VVLTNRSNPP       360
     DAILREVFER SGGKRFGQIE DVVSHAELQA ISDNYKRVAG YDPVALKARA SYL              413
//

If you have problems or comments...

PBIL Back to PBIL home page