(data stored in ACNUC1104 zone)

EMBL: CP002417.PE288

CP002417.PE288       Location/Qualifiers
FT   CDS             304228..304923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34511"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:E6V1E7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0279"
FT                   /protein_id="ADU34511.1"
FT                   /translation="MRTRDHGKPHRLLAAASFFLVAFAAVGVAHAQGKDVPAGSIYTCT
FT                   DAQGRTLTADRPIPACNDREQRELSPSGLTRRKIEPTYSAREMAEREDRAREAAVQAAK
FT                   ATDERRRERALLVRYPSPASHDRERKEALSQVDAVIQAAQKRIAELSEDRQKIDEELEF
FT                   YKKDTSKAPGAMRRKLEDNTQSVAVQNRFIAEQEEEKKRVNARFDEERGRLKPLWGPAP
FT                   SAAAAAASR"
     MRTRDHGKPH RLLAAASFFL VAFAAVGVAH AQGKDVPAGS IYTCTDAQGR TLTADRPIPA        60
     CNDREQRELS PSGLTRRKIE PTYSAREMAE REDRAREAAV QAAKATDERR RERALLVRYP       120
     SPASHDRERK EALSQVDAVI QAAQKRIAEL SEDRQKIDEE LEFYKKDTSK APGAMRRKLE       180
     DNTQSVAVQN RFIAEQEEEK KRVNARFDEE RGRLKPLWGP APSAAAAAAS R                231
//

If you have problems or comments...

PBIL Back to PBIL home page