(data stored in SCRATCH zone)

EMBL: CP002417.PE29

CP002417.PE29        Location/Qualifiers
FT   CDS             complement(32524..33318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0029"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: vap:Vapar_0027 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34252"
FT                   /db_xref="GOA:E6UXQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU34252.1"
FT                   /translation="MSFKPRILIAEDESGIADTLQYVLKSDGFTPVWCATAEEAIAQFA
FT                   EEPPALAILDIGLPDLNGFELFKRLRALNQSQGGPEVPMLFLTARSDEIDRVVGLELGA
FT                   DDYIAKPFSPRELVARVRTILRRSTRNSPGGPGTAAGPGNGVPPQISPPAPPTAPQTPP
FT                   MPFALDNERMQIRYYGRLLELSRYEYGLLRLLVQRPGRVFTRDELLEHVWDDASDSFDR
FT                   TVDAHIKTLRAKLKAVAPDVEPIRTLRGTGYALNEELPAKAS"
     MSFKPRILIA EDESGIADTL QYVLKSDGFT PVWCATAEEA IAQFAEEPPA LAILDIGLPD        60
     LNGFELFKRL RALNQSQGGP EVPMLFLTAR SDEIDRVVGL ELGADDYIAK PFSPRELVAR       120
     VRTILRRSTR NSPGGPGTAA GPGNGVPPQI SPPAPPTAPQ TPPMPFALDN ERMQIRYYGR       180
     LLELSRYEYG LLRLLVQRPG RVFTRDELLE HVWDDASDSF DRTVDAHIKT LRAKLKAVAP       240
     DVEPIRTLRG TGYALNEELP AKAS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page