(data stored in ACNUC1104 zone)

EMBL: CP002417.PE290

CP002417.PE290       Location/Qualifiers
FT   CDS             complement(306458..307951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0291"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="KEGG: vap:Vapar_0281 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34513"
FT                   /db_xref="GOA:E6V282"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6V282"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADU34513.1"
FT                   /translation="MSGEQQLHQMGVVALAKALAERKVSAVEASQAFLGRMKAHESLGT
FT                   FVDVNEEVTLAQARKADALLAAGNAPALAGVPIAHKDIFVTTDFATTAGSKMLAGYRSP
FT                   FDATVVRRLAEAGAVTLGKLSCDEFAMGSANENVAVPAVGHDKAVPVRNPWNRDRIPGG
FT                   SSGASAAAVAARLAPAATGTDTGGSIRQPASFCGVTGIKPTYGRASRYGMVAFASSLDQ
FT                   AGPMARSAEDCALLLSAFCGPDLDRDSTSIDKPAEDFGRALNDSLEGLRIGVPKEFFGE
FT                   GVAPGVRAAIDAALAQYEKLGAKRVEVSLPRTELSIPVYYILAAAEASSNLSRFDGVKF
FT                   GHRAKQYKDLSDMYEKTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKVRRMIADD
FT                   FQQALKQCDVIAGPAAPTTAWKIGEHGDDPVADYLADIFTLPASLAGLPGMSVPAGFDG
FT                   GMPVGLQLIGNYFGEAKLLNAAHRFQQATDWHTRTPEGF"
     MSGEQQLHQM GVVALAKALA ERKVSAVEAS QAFLGRMKAH ESLGTFVDVN EEVTLAQARK        60
     ADALLAAGNA PALAGVPIAH KDIFVTTDFA TTAGSKMLAG YRSPFDATVV RRLAEAGAVT       120
     LGKLSCDEFA MGSANENVAV PAVGHDKAVP VRNPWNRDRI PGGSSGASAA AVAARLAPAA       180
     TGTDTGGSIR QPASFCGVTG IKPTYGRASR YGMVAFASSL DQAGPMARSA EDCALLLSAF       240
     CGPDLDRDST SIDKPAEDFG RALNDSLEGL RIGVPKEFFG EGVAPGVRAA IDAALAQYEK       300
     LGAKRVEVSL PRTELSIPVY YILAAAEASS NLSRFDGVKF GHRAKQYKDL SDMYEKTRAE       360
     GFGDEVKRRI MIGTYVLSHG YYDAYYLQAQ KVRRMIADDF QQALKQCDVI AGPAAPTTAW       420
     KIGEHGDDPV ADYLADIFTL PASLAGLPGM SVPAGFDGGM PVGLQLIGNY FGEAKLLNAA       480
     HRFQQATDWH TRTPEGF                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page