(data stored in ACNUC1104 zone)

EMBL: CP002417.PE292

CP002417.PE292       Location/Qualifiers
FT   CDS             308464..309507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0293"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: vap:Vapar_0283 rod shape-determining protein
FT                   MreB; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34515"
FT                   /db_xref="GOA:E6V284"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6V284"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADU34515.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARNKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTL
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATSVYLIEEPMAAAIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNYGMLIGEPTAEVIKKT
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNNIVSAVKNALEQTPP
FT                   ELGADIADRGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRL
FT                   GSIFTSE"
     MFGAFRRYFS TDLAIDLGTA NTLIFARNKG IVLDEPSVVA IRHEGGPHGK KVIQAVGREA        60
     KAMLGKVPGN IEAIRPMKDG VIADFVITEQ MIKQFIKMVH PRTLLTPSPR IIICVPCGST       120
     QVERRAIKDA AEAAGATSVY LIEEPMAAAI GAGLPVSEAS GSMVVDIGGG TTEVGVISLG       180
     GMVYKGSVRV GGDRFDEAII NYIRRNYGML IGEPTAEVIK KTIGSAFPGS EVKEMEVKGR       240
     NLSEGVPRSF TISSNEVLEA LTDPLNNIVS AVKNALEQTP PELGADIADR GMMLTGGGAL       300
     LRDLDRLLAE ETGLPVLVAE DPLTCVVRGC GIALERMDRL GSIFTSE                     347
//

If you have problems or comments...

PBIL Back to PBIL home page