(data stored in ACNUC1104 zone)

EMBL: CP002417.PE294

CP002417.PE294       Location/Qualifiers
FT   CDS             310568..311089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0295"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: vap:Vapar_0285 rod shape-determining protein
FT                   MreD; TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34517"
FT                   /db_xref="GOA:E6V286"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E6V286"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADU34517.1"
FT                   /translation="MIKRPGQQQLLLPVSPLFMWTSLVVALLVNMIPIGRAAWMPDLLA
FT                   LVIVFWGVHQPSRVGIGAAFVFGLCMDVHQASMLGQHALSYTTLGFFAITIHRRLLWYP
FT                   VLSQALQVLPLFALSQLIEVITRMIGGGVFPGWSVLISPGVEAALWPLASALLLAPQRR
FT                   TPEPDENRPL"
     MIKRPGQQQL LLPVSPLFMW TSLVVALLVN MIPIGRAAWM PDLLALVIVF WGVHQPSRVG        60
     IGAAFVFGLC MDVHQASMLG QHALSYTTLG FFAITIHRRL LWYPVLSQAL QVLPLFALSQ       120
     LIEVITRMIG GGVFPGWSVL ISPGVEAALW PLASALLLAP QRRTPEPDEN RPL              173
//

If you have problems or comments...

PBIL Back to PBIL home page