(data stored in ACNUC1104 zone)

EMBL: CP002417.PE295

CP002417.PE295       Location/Qualifiers
FT   CDS             311144..313114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0296"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein 2; KEGG:
FT                   vap:Vapar_0286 penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34518"
FT                   /db_xref="GOA:E6V287"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6V287"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ADU34518.1"
FT                   /translation="MTEIRNVAADLARFKRRVIVIGLAVLFAFGLLSSRLIYLQVTRHE
FT                   DLAEQAESNRTAIVPVVPNRGLILDRNGIVLASNYSAYTLEITPSKVNDVEETIDNLTQ
FT                   VLEVSPRDRRRFKRLREDSRSFDSIPIRTRLSDEEVARFAAQRYRFPGVEIKARLFRNY
FT                   PNGETGAHVLGYIGRINQREKTAMEDWEEEEQANYKGTDYIGKLGIEQSYEKTLHGQTG
FT                   VEQMETSAGGRAIRRLASHPATPGNTVMLSLDIKLQKLVEDMFGDRRGALVAIDPKTGE
FT                   VLAFVSKPTFDPNLFVEGIDTESWKELSESLDKPLLNRALRGTYPPGSTYKPFMALAAL
FT                   QTGKRGASVVVNDPGYFNFGGHRFGSPEGNLGGVDMRRSIQLSSNIYYYSLANEMGVDL
FT                   IHDFMKPLGFGQITGIDLGGEVRGVLPSTEWKRNAYKRPEQKKWYAGETISLGIGQGYN
FT                   TFTMLQLAQATAIVADGGIKRKPHLVLATRNTVSGQVVPLPQPPPENLGYTAANVAVIR
FT                   EGLTSVVTSGTARSVFAGAGYQAAGKTGTAQAVTQAQNTKYNARALEEHQRDHALFMAF
FT                   APVSDPKIAVAVIVENAGWGAGAAAPIARRVFDYWLMDQYPSEADMAAIKIGKAGAPMG
FT                   KPRVASEVAWPVATTTPATAP"
     MTEIRNVAAD LARFKRRVIV IGLAVLFAFG LLSSRLIYLQ VTRHEDLAEQ AESNRTAIVP        60
     VVPNRGLILD RNGIVLASNY SAYTLEITPS KVNDVEETID NLTQVLEVSP RDRRRFKRLR       120
     EDSRSFDSIP IRTRLSDEEV ARFAAQRYRF PGVEIKARLF RNYPNGETGA HVLGYIGRIN       180
     QREKTAMEDW EEEEQANYKG TDYIGKLGIE QSYEKTLHGQ TGVEQMETSA GGRAIRRLAS       240
     HPATPGNTVM LSLDIKLQKL VEDMFGDRRG ALVAIDPKTG EVLAFVSKPT FDPNLFVEGI       300
     DTESWKELSE SLDKPLLNRA LRGTYPPGST YKPFMALAAL QTGKRGASVV VNDPGYFNFG       360
     GHRFGSPEGN LGGVDMRRSI QLSSNIYYYS LANEMGVDLI HDFMKPLGFG QITGIDLGGE       420
     VRGVLPSTEW KRNAYKRPEQ KKWYAGETIS LGIGQGYNTF TMLQLAQATA IVADGGIKRK       480
     PHLVLATRNT VSGQVVPLPQ PPPENLGYTA ANVAVIREGL TSVVTSGTAR SVFAGAGYQA       540
     AGKTGTAQAV TQAQNTKYNA RALEEHQRDH ALFMAFAPVS DPKIAVAVIV ENAGWGAGAA       600
     APIARRVFDY WLMDQYPSEA DMAAIKIGKA GAPMGKPRVA SEVAWPVATT TPATAP           656
//

If you have problems or comments...

PBIL Back to PBIL home page