(data stored in ACNUC1104 zone)

EMBL: CP002417.PE298

CP002417.PE298       Location/Qualifiers
FT   CDS             complement(315652..316959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0299"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="TIGRFAM: homogentisate 1,2-dioxygenase; KEGG:
FT                   vap:Vapar_0289 homogentisate 1,2-dioxygenase; PFAM:
FT                   homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34521"
FT                   /db_xref="GOA:E6V290"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6V290"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ADU34521.1"
FT                   /translation="MTDIPATERRYLGGFGNEYASEAVPGALPQGRNNPQRGPFDLYTE
FT                   LLSGTAFTAPRHENRRTWLYRRQPSVVSGRYQPYAQPHWTTGGAREIALPPEPMRWHPM
FT                   PLDGAAEADFIDGMHTVAANGDAESQVGIGSLMYLAGRSMDKRAFVNADGEMLVVPQQG
FT                   RLVITTELGVLDVKPGEIAVLPRGMVFKVALPDGLSRGYVCENYGAHFRLPELGPIGSN
FT                   GLANARDFQAPVAAFEEDGGAYELVKKFAGRFWKAPTKQSPFNVVAWHGNLAPVKYDTA
FT                   RFMAIGSISFDHPDPSIFTVLTSPSDTPGTANCDFVIFPPRWMVMENTFRPPWFHRNLM
FT                   SEFMGLVLGEYDAKPGGFKPGGASLHNCMVPHGPDEEAFDKATHADLKPHKLDNTLAFM
FT                   FESRFRFIPTNFALKSPALDTDYADCWAGLKDQFKP"
     MTDIPATERR YLGGFGNEYA SEAVPGALPQ GRNNPQRGPF DLYTELLSGT AFTAPRHENR        60
     RTWLYRRQPS VVSGRYQPYA QPHWTTGGAR EIALPPEPMR WHPMPLDGAA EADFIDGMHT       120
     VAANGDAESQ VGIGSLMYLA GRSMDKRAFV NADGEMLVVP QQGRLVITTE LGVLDVKPGE       180
     IAVLPRGMVF KVALPDGLSR GYVCENYGAH FRLPELGPIG SNGLANARDF QAPVAAFEED       240
     GGAYELVKKF AGRFWKAPTK QSPFNVVAWH GNLAPVKYDT ARFMAIGSIS FDHPDPSIFT       300
     VLTSPSDTPG TANCDFVIFP PRWMVMENTF RPPWFHRNLM SEFMGLVLGE YDAKPGGFKP       360
     GGASLHNCMV PHGPDEEAFD KATHADLKPH KLDNTLAFMF ESRFRFIPTN FALKSPALDT       420
     DYADCWAGLK DQFKP                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page