(data stored in ACNUC1104 zone)

EMBL: CP002417.PE299

CP002417.PE299       Location/Qualifiers
FT   CDS             complement(317002..317193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34522"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:E6V291"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0290"
FT                   /protein_id="ADU34522.1"
FT                   /translation="MQALITTPNLEAPDDFYEALIAAHQGLSTEESHAFNARLALVLAN
FT                   HIGSLAVLREAFEAARGS"
     MQALITTPNL EAPDDFYEAL IAAHQGLSTE ESHAFNARLA LVLANHIGSL AVLREAFEAA        60
     RGS                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page