(data stored in SCRATCH zone)

EMBL: CP002417.PE3

CP002417.PE3         Location/Qualifiers
FT   CDS             2798..5419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; KEGG: vap:Vapar_0003 DNA gyrase, B subunit; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34226"
FT                   /db_xref="GOA:E6UXN2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU34226.1"
FT                   /translation="MSAEENKPEVPHTEPVYTPEVQVVAPEVILADTSYGEGSITILEG
FT                   LEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHSDNSISVTDN
FT                   GRGIPTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSIK
FT                   LRLIVRREGKIHELEFSRGFVQNRLLETVNGFEVSPMKIIGDTDKRGTEVHFLPDTEIF
FT                   KENNDFHYEILSKRLRELSFLNNGVRIRLLDERTGKEDDFSGAGGVRGFVEFINKGKTV
FT                   LHPNSFYAAGEKPADTYGGIPGTHIGVEVAMQWNSGYNEQVLCFTNNIPQRDGGTHLTG
FT                   LRAAMTRVINKYIEENEFAKKAKVEVTGDDMREGLCCVLSVKVPEPKFSSQTKDKLVSS
FT                   EVRAPVEDIVGRLLTDYLQERPNDAKIICGKIVEAARAREAARKAREMTRRKGVLDGMG
FT                   LPGKLADCQEKDPALCEVYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKL
FT                   LTSNEILTMITALGTGIGRAGATTAGGGADDFNVAKLRYHRIIIMTDADVDGAHIRTLL
FT                   LTFFYRQMPELVERGHIYIAQPPLYKVKVGKEEQYLKDGPALDAFLLKVALKDARIETG
FT                   GASSTTLTGDTLAELARKHQVAESVIARLRNFMDAEALRAIADGVALDLDTTPAAEASA
FT                   VALQAKLRELNTTGIPAEVSNEFDARTDKPLLRISRRHHGNIKSSVITQDFVHGADYAA
FT                   LAEAANTFRGLLSTEGALVKRGEGERAKEEKVDDFRQAMKWLISEAERATSRQRYKGLG
FT                   EMNPEQLWETTMDPTVRRLLRVQIDDAIEADRVFTMLMGDEVEPRREFIEQNALRAANI
FT                   DV"
     MSAEENKPEV PHTEPVYTPE VQVVAPEVIL ADTSYGEGSI TILEGLEAVR KRPGMYIGDT        60
     SDGTGLHHLV FEVVDNSIDE ALAGHCDDIV VTIHSDNSIS VTDNGRGIPT GVKMDDKHEP       120
     KRSAAEIALT ELHAGGKFNQ NSYKVSGGLH GVGVSCVNAL SIKLRLIVRR EGKIHELEFS       180
     RGFVQNRLLE TVNGFEVSPM KIIGDTDKRG TEVHFLPDTE IFKENNDFHY EILSKRLREL       240
     SFLNNGVRIR LLDERTGKED DFSGAGGVRG FVEFINKGKT VLHPNSFYAA GEKPADTYGG       300
     IPGTHIGVEV AMQWNSGYNE QVLCFTNNIP QRDGGTHLTG LRAAMTRVIN KYIEENEFAK       360
     KAKVEVTGDD MREGLCCVLS VKVPEPKFSS QTKDKLVSSE VRAPVEDIVG RLLTDYLQER       420
     PNDAKIICGK IVEAARAREA ARKAREMTRR KGVLDGMGLP GKLADCQEKD PALCEVYLVE       480
     GDSAGGSAKQ GRDRKFQAIL PLRGKILNVE KARYEKLLTS NEILTMITAL GTGIGRAGAT       540
     TAGGGADDFN VAKLRYHRII IMTDADVDGA HIRTLLLTFF YRQMPELVER GHIYIAQPPL       600
     YKVKVGKEEQ YLKDGPALDA FLLKVALKDA RIETGGASST TLTGDTLAEL ARKHQVAESV       660
     IARLRNFMDA EALRAIADGV ALDLDTTPAA EASAVALQAK LRELNTTGIP AEVSNEFDAR       720
     TDKPLLRISR RHHGNIKSSV ITQDFVHGAD YAALAEAANT FRGLLSTEGA LVKRGEGERA       780
     KEEKVDDFRQ AMKWLISEAE RATSRQRYKG LGEMNPEQLW ETTMDPTVRR LLRVQIDDAI       840
     EADRVFTMLM GDEVEPRREF IEQNALRAAN IDV                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page