(data stored in ACNUC1104 zone)

EMBL: CP002417.PE300

CP002417.PE300       Location/Qualifiers
FT   CDS             complement(317207..318928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0301"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   vap:Vapar_0291 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34523"
FT                   /db_xref="GOA:E6V292"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V292"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34523.1"
FT                   /translation="MIDYQSLRFDYRRHADQDAAPPAHHPVVIVGAGPVGLTLAIDLAL
FT                   RQVPVVLLDNDNTLSSGSRAICFAKRSLEVFDRLGCGDRMVDKGVSWSVGKVFFHDEQV
FT                   YRFDLLPEPGHERPAFINLQQYYVEGYLVERAAALPLIDLRWNNKVTGIEQRDEGAVLT
FT                   VETPEGNYQLAAGYVAACDGSRSNLRQLLGQEAKGRTFRDRFLIADITMDAGPPPGRPK
FT                   ADAPPSGGQRGHEVPSVGGDILPTERRFWFDPSFHPGQSVLLHKQADGMWRVDFQLGWD
FT                   ADPVEERKPENITPRVRALLDSIGFADVQFQIGWASVYTFACQRMERFRHGRVLFAGDS
FT                   AHGVSPFGARGANSGVQDADNLAWKLAAVLKGDAPDALLDSYASEREYAADENIRHSTR
FT                   ATDFITPKSEVSRLFRDAVLELTKRHAFARTLVNSGRLSVPAVLRDSPLNTVDADAFKG
FT                   AMVPGAAAADAPAVRADGSTGWLLRECHGQQFTALVFGAGEAAERSAEVLKAFDAPLHI
FT                   VRVQGTTPEGELATQRYDAQPGTVYLLRPDQHVCARWRQPTPANIRAAIDRALARA"
     MIDYQSLRFD YRRHADQDAA PPAHHPVVIV GAGPVGLTLA IDLALRQVPV VLLDNDNTLS        60
     SGSRAICFAK RSLEVFDRLG CGDRMVDKGV SWSVGKVFFH DEQVYRFDLL PEPGHERPAF       120
     INLQQYYVEG YLVERAAALP LIDLRWNNKV TGIEQRDEGA VLTVETPEGN YQLAAGYVAA       180
     CDGSRSNLRQ LLGQEAKGRT FRDRFLIADI TMDAGPPPGR PKADAPPSGG QRGHEVPSVG       240
     GDILPTERRF WFDPSFHPGQ SVLLHKQADG MWRVDFQLGW DADPVEERKP ENITPRVRAL       300
     LDSIGFADVQ FQIGWASVYT FACQRMERFR HGRVLFAGDS AHGVSPFGAR GANSGVQDAD       360
     NLAWKLAAVL KGDAPDALLD SYASEREYAA DENIRHSTRA TDFITPKSEV SRLFRDAVLE       420
     LTKRHAFART LVNSGRLSVP AVLRDSPLNT VDADAFKGAM VPGAAAADAP AVRADGSTGW       480
     LLRECHGQQF TALVFGAGEA AERSAEVLKA FDAPLHIVRV QGTTPEGELA TQRYDAQPGT       540
     VYLLRPDQHV CARWRQPTPA NIRAAIDRAL ARA                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page